PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03479.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 498aa    MW: 56855.9 Da    PI: 7.2448
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03479.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox314.4e-103473841954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Rsa1.0_03479.1_g00003.1 347 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 384
                              665559******************************88 PP

2BELL123.68e-40208279172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vag+g+akpYts+Al++iSrhFrcL+dai+eq+
  Rsa1.0_03479.1_g00003.1 208 ERQELQSKKNKLLTMVDEVDKRYNQYYHQMEALASSFEMVAGHGAAKPYTSVALNRISRHFRCLRDAIKEQV 279
                              79********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.4E-51145277IPR006563POX domain
PfamPF075263.3E-48151275IPR006563POX domain
PROSITE profilePS5007112.503325388IPR001356Homeobox domain
SMARTSM003896.5E-10328392IPR001356Homeobox domain
CDDcd000861.07E-11328389No hitNo description
SuperFamilySSF466896.42E-18329396IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28331394IPR009057Homeodomain-like
PfamPF059206.1E-18345384IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MAVYYPTSVG MQSLYQEPIY LNEQPQQQQQ QQQQASSSSA ASFSGAGAGV NCLEIPNSVP  60
NEMVFIPPTS DASLINGNVT VVSNNDLSFH GGGLSLSLGN QIHYHYQNLS NQLSYNNHHQ  120
NPDENAKSFS HHNHHQVPSF GFYNNGFVSS VLRSRYLKPT QQLLDEVVSV KKTNKNNNEK  180
GQDFTNGSKP NDNNNNTEKN EQNLSPTERQ ELQSKKNKLL TMVDEVDKRY NQYYHQMEAL  240
ASSFEMVAGH GAAKPYTSVA LNRISRHFRC LRDAIKEQVQ VIRGKLGENS KESCEEHEER  300
IPRLRYLDQR LRQQRALHQQ LGMVRPSWRP QRGLPENSVS ILRAWLFEHF LHPYPKESEK  360
IMLAKQTGLS KNQVANWFIN ARVRLWKPMI EEMYKEEFGD SPELLSNSNQ DSNKKKRMNE  420
TSQLKHEDSS SSQQQNHGNN NIHYTSDAEE NLIFADPKPD SLMNYNGFGV GDYNGYIGLG  480
NQQDGRFSNP HQLHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16334392563Homeobox protein Meis2
3k2a_B4e-16334392563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013693285.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_013693278.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A078HN930.0A0A078HN93_BRANA; BnaA02g17200D protein
STRINGBra008197.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3